missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SFMBT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3275.00 NOK - 4675.00 NOK
Specifications
Antigen | SFMBT1 |
---|---|
Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 ÎĽg/mL |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18649626
|
Novus Biologicals
NBP2-48652 |
0.1 mL |
4675.00 NOK
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18669957
|
Novus Biologicals
NBP2-48652-25ul |
25 ÎĽL |
3275.00 NOK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SFMBT1 Polyclonal antibody specifically detects SFMBT1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
SFMBT1 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Human | |
DKFZp434L243, Renal ubiquitous protein 1, RU1scm-like with four MBT domains protein 1, Scm-like with four mbt domains 1, Scm-related gene containing four mbt domains, Scm-related gene product containing four mbt domains, SFMBT | |
This antibody was developed against a recombinant protein corresponding to amino acids: DIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDS | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry/ Immunofluorescence 0.25-2 ÎĽg/mL | |
Polyclonal | |
Purified | |
RUO | |
PBS (pH 7.2), 40% Glycerol | |
51460 | |
IgG | |
Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
SFMBT1 Antibody, Novus Biologicals™