missing translation for 'onlineSavingsMsg'
Learn More

SFMBT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-48652-25ul

View more versions of this product

Product Code. 18669957

3275.00 NOK / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

SFMBT1 Polyclonal antibody specifically detects SFMBT1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	SFMBT1
Classification	Polyclonal
Dilution	Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Gene Alias	DKFZp434L243, Renal ubiquitous protein 1, RU1scm-like with four MBT domains protein 1, Scm-like with four mbt domains 1, Scm-related gene containing four mbt domains, Scm-related gene product containing four mbt domains, SFMBT
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: DIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDS
Quantity	25 μL
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS (pH 7.2), 40% Glycerol
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	51460
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Customers who viewed this item also viewed This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10125092

Invitrogen ™ Phalloidin Labeling Probes Invitrogen ™ Phalloidin Labeling Probes

kr 7 680,00 / 300 units
Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

kr 1 550,00 / 500mL
Catalog No. 10671531

Thermo Scientific ™ 3000 Series Nanosphere ™ Thermo Scientific ™ 3000 Series Nanosphere ™

kr 4 087,20 / 15mL
Catalog No. 13464189

Thermo Scientific ™ Mass Spectrometry Grade Pr Thermo Scientific ™ Mass Spectrometry Grade Pr

kr 800,00 / Pack of 5
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

kr 2 145,00 / 250mL
Catalog No. 10116287

Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta

kr 1 424,00 / 1mL
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

kr 2 280,00 / 100µg
Catalog No. 11570806

Invitrogen ™ Wheat Germ Agglutinin (WGA) Invitrogen ™ Wheat Germ Agglutinin (WGA)

kr 5 430,00 / 5mg
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

kr 840,00 / 100µg
Catalog No. 15137105

Applied Biosystems ™ ProFlex ™ PCR System, 96 Applied Biosystems ™ ProFlex ™ PCR System, 96

kr 114 950,00 / Each
Catalog No. 10347642

V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge

kr 2 770,00 / Each
Catalog No. 11514270

Trenbolone Polyclonal Antibody, Invitrogen ™ Trenbolone Polyclonal Antibody, Invitrogen ™

kr 6 970,00 / 100µL

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

SFMBT1 Antibody, Novus Biologicals™ > 25 μL, Unconjugated

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

SFMBT1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Special Offers

You recently viewed...Show