missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SFMBT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48652-25ul
This item is not returnable.
View return policy
Description
SFMBT1 Polyclonal antibody specifically detects SFMBT1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
SFMBT1 | |
Polyclonal | |
Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
DKFZp434L243, Renal ubiquitous protein 1, RU1scm-like with four MBT domains protein 1, Scm-like with four mbt domains 1, Scm-related gene containing four mbt domains, Scm-related gene product containing four mbt domains, SFMBT | |
This antibody was developed against a recombinant protein corresponding to amino acids: DIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDS | |
25 μL | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
51460 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
SFMBT1 Antibody, Novus Biologicals™ > 25 μL, Unconjugated
Spot an opportunity for improvement?Share a Content Correction