missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Polypeptide GalNac Transferase 7/GALNT7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09941-100UL
This item is not returnable.
View return policy
Description
Polypeptide GalNac Transferase 7/GALNT7 Polyclonal specifically detects Polypeptide GalNac Transferase 7/GALNT7 in Human samples. It is validated for Western Blot.Specifications
Polypeptide GalNac Transferase 7/GALNT7 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
EC 2.4.1, EC 2.4.1.-, EC 2.4.1.37, EC 2.4.1.41, GalNAcT7, GalNAc-T7, N-acetylgalactosaminyltransferase 7, Polypeptide GalNAc transferase 7, polypeptide N-acetylgalactosaminyltransferase 7, pp-GaNTase 7, Protein-UDP acetylgalactosaminyltransferase 7, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 7 (GalNAc-T7) | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Polypeptide GalNac Transferase 7/GALNT7. Peptide sequence SPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESI | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
51809 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction