missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FOSL2 (Human) Recombinant Protein

Human FOSL2 full-length ORF ( AAH08899, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

4115.00 NOK - 6245.00 NOK

Accession Number	AAH08899
Gene ID (Entrez)	2355
Name	FOS-like antigen 2
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16115131 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00002355-P01.10ug	10 μg	4115.00 NOK 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

16125131 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00002355-P01.25ug	25 μg	6245.00 NOK 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC

Specifications

Accession Number	AAH08899
Name	FOS-like antigen 2
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	FLJ23306, FRA2
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	2355
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	FOSL2
Protein Tag	GST

Safety and Handling

missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein

Description