missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF214 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3275.00 NOK - 4675.00 NOK
Specifications
Antigen | ZNF214 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18449541
|
Novus Biologicals
NBP2-31602-25ul |
25 μL |
3275.00 NOK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18152504
|
Bio-Techne
NBP2-31602 |
0.1 mL |
4675.00 NOK
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF214 Polyclonal specifically detects ZNF214 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ZNF214 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
BAZ 1, BAZ1, BAZ-1, BWSCR2-Associated Zinc Finger Protein 1, DKFZp564D0764, early hematopoietic zinc finger, Early hematopoietic zinc finger protein, EHZFLIP3, Evi3, LYST-interacting protein 3, MGC142182, MGC142208, zinc finger protein 521 | |
ZNF214 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Human | |
Q9UL59 | |
7761 | |
This antibody was developed against a recombinant protein corresponding to amino acids: CGCNKCKGIYYWNSRCVFHKRNQPGENLCQCSIRKACFSQRSDLYRHPRNHIGKKLYGCDEVDGNFHQSSGVHFH | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
ZNF214 Antibody, Novus Biologicals™