missing translation for 'onlineSavingsMsg'
Learn More
Learn More
-Immunocytochemistry-Immunofluorescence-NBP3-16621-img0001.jpg-650.jpg)
-Western-Blot-NBP3-16621-img0002.jpg-650.jpg)
-Immunocytochemistry-Immunofluorescence-NBP3-16621-img0001.jpg-150.jpg)
-Western-Blot-NBP3-16621-img0002.jpg-150.jpg)
TWEAK R/TNFRSF12 Rabbit anti-Human, Mouse, Rat, Clone: 1G4T3, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Bio-Techne NBP3-16621-20UL
This item is not returnable.
View return policy
Description
TWEAK R/TNFRSF12 Monoclonal antibody specifically detects TWEAK R/TNFRSF12 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
Specifications
| TWEAK R/TNFRSF12 | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunofluorescence | |
| 1G4T3 | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| CD266, CD266 antigen, FGF-inducible 14, Fibroblast growth factor-inducible immediate-early response protein 14, FN14tumor necrosis factor receptor superfamily member 12A, tumor necrosis factor receptor superfamily, member 12A, TweakR, Tweak-receptor, type I transmembrane protein Fn14 | |
| A synthetic peptide corresponding to a sequence within amino acids 50-129 of human TWEAK R/TNFRSF12 (Q9NP84). MDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ | |
| 20 μg | |
| Angiogenesis, Apoptosis, Biologically Active Proteins, Cancer, Tumor Suppressors | |
| 51330 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
TWEAK R/TNFRSF12 Rabbit anti-Human, Mouse, Rat, Clone: 1G4T3, Novus Biologicals™ > 20 μg; Unconjugated
Spot an opportunity for improvement?Share a Content Correction