missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Smad5 Antibody (3A10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00004090-M03
This item is not returnable.
View return policy
Description
Smad5 Monoclonal antibody specifically detects Smad5 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ ImmunofluorescenceSpecifications
Smad5 | |
Monoclonal | |
Unconjugated | |
In 1x PBS, pH 7.4 | |
hSmad5, JV5-1DKFZp781O1323, MAD homolog 5, MAD, mothers against decapentaplegic homolog 5 (Drosophila), MADH5mothers against decapentaplegic homolog 5, mothers against decapentaplegic homolog 5, mothers against decapentaplegic, drosophila, homolog of, 5, Mothers against DPP homolog 5, SMA- and MAD-related protein 5, SMAD 5, SMAD family member 5DKFZp781C1895, SMAD, mothers against DPP homolog 5, SMAD, mothers against DPP homolog 5 (Drosophila), Smad5 | |
SMAD5 (AAH09682, 105 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN | |
0.1 mg | |
Signal Transduction | |
4090 | |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
IgG2a κ |
Western Blot, ELISA, Immunocytochemistry | |
3A10 | |
Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
AAH09682 | |
Mouse | |
IgG purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction