missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAGE4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4250.00 NOK
Specifications
| Antigen | PAGE4 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PAGE4 Polyclonal specifically detects PAGE4 in Human samples. It is validated for Western Blot.Specifications
| PAGE4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Neuroscience, Vision | |
| PBS buffer, 2% sucrose | |
| 9506 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CT16.7, G antigen family C member 1, G antigen, family C, 1, GAGEC1GAGE-9, JM-27, P antigen family, member 4 (prostate associated), PAGE-1, PAGE-4FLJ35184, Prostate-associated gene 4 protein, prostate-associated gene protein 4 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human PAGE4 (XP_005278137). Peptide sequence DGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDC | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title