missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NXT2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93010-0.02ml
This item is not returnable.
View return policy
Description
NXT2 Polyclonal antibody specifically detects NXT2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
NXT2 | |
Polyclonal | |
Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
BM-025, NTF2-related export protein 2, nuclear transport factor 2-like export factor 2, protein p15-2 | |
Recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human NXT2 (NP_061168.2). GLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNT | |
0.02 mL | |
Signal Transduction | |
55916 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.3), 50% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
NXT2 Antibody - Azide and BSA Free, Novus Biologicals™ > 0.02 mL, Unconjugated
Spot an opportunity for improvement?Share a Content Correction