missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAPK1IP1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP1-88420
This item is not returnable.
View return policy
Description
MAPK1IP1L Polyclonal specifically detects MAPK1IP1L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
MAPK1IP1L | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
c14_5346, C14orf32, chromosome 14 open reading frame 32, MAPK-interacting and spindle-stabilizing protein, MAPK-interacting and spindle-stabilizing protein-like, MGC23138, MISS, mitogen activated protein kinase 1 interacting protein 1-like, mitogen-activated protein kinase 1 interacting protein 1-like, Mitogen-activated protein kinase 1-interacting protein 1-like | |
Rabbit | |
Affinity Purified | |
RUO | |
93487 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
MAPK1IP1L | |
This antibody was developed against Recombinant Protein corresponding to amino acids:APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Suggestions
Customers who viewed this item also viewed
Viewing 1-5 of 12
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
MAPK1IP1L Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction