missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LSM6 Antibody (4B5-1B10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00011157-M01
This item is not returnable.
View return policy
Description
LSM6 Monoclonal antibody specifically detects LSM6 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ ImmunofluorescenceSpecifications
LSM6 | |
Monoclonal | |
Unconjugated | |
In 1x PBS, pH 7.4 | |
LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), Sm protein F, U6 snRNA-associated Sm-like protein LSm6, YDR378C | |
LSM6 (AAH16026, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM | |
0.1 mg | |
Primary | |
Human | |
Purified |
Western Blot, ELISA, Immunocytochemistry | |
4B5-1B10 | |
Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
AAH16026 | |
Mouse | |
IgG purified | |
RUO | |
11157 | |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction