missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ID3 (Human) Recombinant Protein

Human ID3 full-length ORF ( AAH03107, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.

Accession Number	AAH03107
Gene ID (Entrez)	3399
Name	inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16189774 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00003399-P01.10ug	10 μg	N/A View alternative products Save Up to »	N/A

16199774 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00003399-P01.25ug	25 μg	N/A View alternative products Save Up to »	N/A

Description

Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH

Specifications

Accession Number	AAH03107
Name	inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	HEIR-1, bHLHb25
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	3399
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	ID3
Protein Tag	GST

Safety and Handling

missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein

Description