missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ID3 (Human) Recombinant Protein
Human ID3 full-length ORF ( AAH03107, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.
Specifications
Accession Number | AAH03107 |
---|---|
Gene ID (Entrez) | 3399 |
Name | inhibitor of DNA binding 3, dominant negative helix-loop-helix protein |
Preparation Method | Wheat germ expression system |
Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
Description
- Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
Specifications
AAH03107 | |
inhibitor of DNA binding 3, dominant negative helix-loop-helix protein | |
125% SDS-PAGE Stained with Coomassie Blue | |
HEIR-1, bHLHb25 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
3399 | |
Wheat germ expression system | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ID3 | |
GST |
Safety and Handling
missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein