missing translation for 'onlineSavingsMsg'
Learn More

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

3410.00 NOK - 4760.00 NOK

Specifications

Antigen	Hydrogen Potassium ATPase Beta
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18446911 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-32035-25ul	25 μL	3410.00 NOK 25µL		Please sign in to purchase this item. Need a web account? Register with us today!

18135255 View Documents missing translation for 'viewProductCertificates'	Bio-Techne NBP2-32035	0.1 mL	4760.00 NOK 0.10mL		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Hydrogen Potassium ATPase Beta Polyclonal specifically detects Hydrogen Potassium ATPase Beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Hydrogen Potassium ATPase Beta
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene Symbols	ATP4B
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	P51164
Gene ID (Entrez)	496
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents