missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human WDR77 Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP94077
This item is not returnable.
View return policy
Description
WDR77 is a component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles.
Specifications
| Q9BQA1 | |
| Blocking Assay, Control | |
| 79084 | |
| 100 μL | |
| RUO | |
| WDR77 | |
| Human | |
| SEDCSIAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| WDR77 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 2610003I18Rik; 2610312E17Rik; Ac2-269; androgen receptor cofactor p44; C79984; HKMT1069; MEP50; MEP-50; Methylosome protein 50; MGC2722; Nbla10071; OTTHUMP00000013473; p44; p44/Mep50; RGD1310479; RP11-552M11.3; testis tissue sperm-binding protein Li 44a; WD repeat domain 77; WD repeat-containing protein 77; WD45; WDR77 | |
| Unconjugated | |
| Recombinant | |
| E. coli |