Learn More
Invitrogen™ Human LGSN (aa 223-313) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP94881
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56601 (PA5-56601. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May act as a component of the cytoskeleton or as a chaperone for the reorganization of intermediate filament proteins during terminal differentiation in the lens. Does not seem to have enzymatic activity.
Specifications
Q5TDP6 | |
Blocking Assay, Control | |
51557 | |
100 ÎĽL | |
GLULD1; glutamate-ammonia ligase (glutamine synthase) domain containing 1; glutamate-ammonia ligase domain-containing protein 1; Lengsin; lengsin, lens protein with glutamine synthetase domain; Lens glutamine synthase-like; LGS; LGSN | |
LGSN | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human LGSN (aa 223-313) Control Fragment | |
RUO | |
LGSN | |
Unconjugated | |
Recombinant | |
IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.