missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human IRX3 Partial ORF (NP_077312, 182 a.a. - 285 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00079191-Q01.10ug
This item is not returnable.
View return policy
Description
IRX3 is a member of the Iroquois homeobox gene family (see IRX1; MIM 606197) and plays a role in an early step of neural development (Bellefroid et al., 1998 [PubMed 9427753]). Members of this family appear to play multiple roles during pattern formation of vertebrate embryos (Lewis et al., 1999 [PubMed 10370142]).[supplied by OMIM]
Sequence: RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPISpecifications
NP_077312 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.18kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI | |
RUO | |
IRX3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
79191 | |
IRX3 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
IRX-1 | |
IRX3 | |
Recombinant | |
wheat germ expression system |