Learn More
Invitrogen™ Human Glutamine Synthetase (aa 68-208) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP88685
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82295 (PA5-82295. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Glutamine synthase is part of the glutamine synthetase family. Ammonia incorporation in animals occurs through the actions of glutamate dehydrogenase and glutamine synthase. Glutamate plays the central role in mammalian nitrogen flow, serving as both a nitrogen donor and nitrogen acceptor. It also has an important role in controlling metabolic regulations of neurotransmitter glutamate. Because of the multiple functions and importance of GS in cellular metabolism, both catalytic activities and synthesis are highly regulated. The activity of GS is controlled by adenylylation. Its activity is decreased in the cerebral cortex of brains affected by Alzheimer's disease, particularly in the vicinity of senile plaques. It is also decreased under conditions of glucose deprivation.
Specifications
P15104 | |
Blocking Assay, Control | |
2752 | |
100 ÎĽL | |
cell proliferation-inducing protein 59; GLNA; GLNS; Glul; GLUL protein; Glutamate ammonia ligase; glutamate decarboxylase; glutamate-ammonia ligase; glutamate--ammonia ligase; glutamate-ammonia ligase (glutamine synthase); glutamate-ammonia ligase (glutamine synthetase); glutamine synthase; glutamine synthetase; Glutamine synthetase (glutamate-ammonia ligase); glutamine synthetase 1; glutamine synthetase I; GS; Palmitoyltransferase GLUL; PIG43; PIG59; Proliferation inducing protein 43; proliferation-inducing protein 43 | |
GLUL | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Glutamine Synthetase (aa 68-208) Control Fragment | |
RUO | |
Glutamine Synthetase | |
Unconjugated | |
Recombinant | |
LQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.