Learn More
Invitrogen™ Human FNDC1 (aa 1535-1633) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP104190
2056.76 NOK valid until 2025-03-21
Use promo code "24111" to get your promotional price.
Alert:
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56603 (PA5-56603. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications
Q4ZHG4 | |
Blocking Assay, Control | |
84624 | |
100 μL | |
1110027O12Rik; 1110051A18Rik; Activation-associated cDNA protein; activator of G-protein signaling 8; AGS8; bA243O10.1; dJ322A24.1; expressed in synovial lining protein; fibronectin type III domain containing 1; fibronectin type III domain containing 2; fibronectin type III domain-containing protein 1; FNDC1; FNDC2; KIAA1866; MEL4B3; mKIAA1866 | |
FNDC1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human FNDC1 (aa 1535-1633) Control Fragment | |
RUO | |
FNDC1 | |
Unconjugated | |
Recombinant | |
ECYAEEDEFSGLETDTAVPTEEAYVIYDEDYEFETSRPPTTTEPSTTATTPRVIPEEGAISSFPEEEFDLAGRKRFVAPYVTYLNKDPSAPCSLTDALD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Product Suggestions
Customers who viewed this item also viewed
Your input is important to us. Please complete this form to provide feedback related to the content on this product.