missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FAM91A1 (aa 607-686) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP93961

Product Code. 30207473

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

FAM91A1 (family with sequence similarity 91, member A1) is a 94 kDa phospho-protein that is not yet characterized.

Specifications

Accession Number	Q658Y4
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	157769
Quantity	100 μL
Regulatory Status	RUO
Gene Symbol	FAM91A1
Species	Human
Sequence	LHGIGETVHVPFPFDETELQGEFTRVNMGVHKALQILRNRVDLQHLCGYVTMLNASSQLADRKLSDASDERGEPDLASGS
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	FAM91A1
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	AV220772; BC033609; D15Ertd621e; DNA segment, Chr 15, ERATO Doi 621, expressed; Fam91a1; family with sequence similarity 91 member A1; family with sequence similarity 91, member A1; hypothetical protein FLJ23790; hypothetical protein LOC393413; Kiaa0493; mKIAA0493; Protein FAM91A1; si:dkey-5e12.2; skeletal muscle cells re-entry induced; SKIN; zgc:63609
Conjugate	Unconjugated
Recombinant	Recombinant
Expression System	E. coli

Product Suggestions

Description