Learn More
Invitrogen™ Human Carbonic Anhydrase XIV (aa 19-163) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP90144
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82355 (PA5-82355. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CA14 belongs a large family of zinc metalloenzymes that catalyze the versible hydration of carbon dioxide. The protein is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles.
Specifications
Q9ULX7 | |
Blocking Assay, Control | |
23632 | |
100 ÎĽL | |
AW536446; CA XIV; CA14; Car14; Carbonate dehydratase XIV; carbonic anhydrase 14; Carbonic anhydrase XIV; carbonic dehydratase; Catm; CAXiV; CA-XIV; UNQ690/PRO1335 | |
CA14 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Carbonic Anhydrase XIV (aa 19-163) Control Fragment | |
RUO | |
Carbonic Anhydrase XIV | |
Unconjugated | |
Recombinant | |
GQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGIL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.