missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Carbonic Anhydrase XIII (aa 10-92) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP93943

Product Code. 30203696

3085.00 NOK / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55154 (PA5-55154. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM, Mar 2008].

Specifications

Accession Number	Q8N1Q1
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	377677
Quantity	100 μL
Gene Alias	2310075C21Rik; Ca13; Car13; Carbonate dehydratase XIII; carbonic anhydrase 13; Carbonic anhydrase XIII; CAXIII; CA-XIII; RGD1560453
Gene Symbol	Ca13
Species	Human
Protein Tag	His-ABP-tag
Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1 M urea, PBS with no preservative; pH 7.4
Name	Human Carbonic Anhydrase XIII (aa 10-92) Control Fragment
Regulatory Status	RUO
Common Name	Carbonic Anhydrase XIII
Conjugate	Unconjugated
Recombinant	Recombinant
Sequence	EHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLR
Expression System	E. coli
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Invitrogen™ Human Carbonic Anhydrase XIII (aa 10-92) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Invitrogen™ Human Carbonic Anhydrase XIII (aa 10-92) Control Fragment Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Special Offers