missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Carbonic Anhydrase X (aa 275-328) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP106797
This item is not returnable.
View return policy
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66106 (PA5-66106. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene.
Specifications
| Q9NS85 | |
| Blocking Assay, Control | |
| 56934 | |
| 100 μL | |
| 2700029L05Rik; BB085816; Ca10; Car10; carbonic anhydrase 10; carbonic anhydrase X; carbonic anhydrase-related protein 10; Carbonic anhydrase-related protein X; CARP X; CA-RP X; CARPX; CA-RPX; Cerebral protein 15; cerebral protein-15; HUCEP-15; UNQ533/PRO1076 | |
| CA10 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Carbonic Anhydrase x (aa 275-328) Control Fragment | |
| RUO | |
| Carbonic Anhydrase X | |
| Unconjugated | |
| Recombinant | |
| PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human Carbonic Anhydrase X (aa 275-328) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction
