Learn More
Invitrogen™ Human Carbonic Anhydrase VIII (aa 189-279) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP93924
Description
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82894 (PA5-82894. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form.
Specifications
P35219 | |
Blocking Assay, Control | |
767 | |
100 ÎĽL | |
AW546993; Ca8; Cals; Cals1; CAMRQ3; Car8; carbonate dehydratase; carbonic anhydrase 8; carbonic anhydrase VIII; carbonic anhydrase-like sequence; carbonic anhydrase-like sequence 1; carbonic anhydrase-related protein; CA-related protein; CARP; CA-RP; CARP VIII; CA-RP VIII; CA-VIII; hypothetical protein LOC550233; LOW QUALITY PROTEIN: carbonic anhydrase-related protein; MGC120502; MGC99509; wdl; zgc:110118 | |
Ca8 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Carbonic Anhydrase VIII (aa 189-279) Control Fragment | |
RUO | |
Carbonic Anhydrase VIII | |
Unconjugated | |
Recombinant | |
IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.