Learn More
Invitrogen™ Human Carbonic Anhydrase VI (aa 222-293) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP94192
Description
Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83019 (PA5-83019. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown.
Specifications
P23280 | |
Blocking Assay, Control | |
765 | |
100 μL | |
CA6; CA-6; Car6; Carbonate dehydratase VI; carbonic anhydrase 6; Carbonic anhydrase VI; carbonic anhydrase VI nirs variant 2; Carbonic anhydrase6; CA-VI; DOC1; GUSTIN; salivary carbonic anhydrase; Secreted carbonic anhydrase | |
CA6 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Carbonic Anhydrase VI (aa 222-293) Control Fragment | |
RUO | |
Carbonic Anhydrase VI | |
Unconjugated | |
Recombinant | |
PPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.