Learn More
Invitrogen™ Human Carbonic Anhydrase VB (aa 176-279) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP92233
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52959 (PA5-52959. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Carbonic anhydrases (CAs) are members of a large family of zinc metalloenzymes responsible for catalyzing the reversible hydration of carbon dioxide.CAs show extensive diversity in their distribution and subcellular localization.They are involved in a variety of biological processes, including calcification, bone resorption, respiration, acid-base balance and the formation of aqueous humor, saliva, gastric juice and cerebrospinal fluid. CA VB, also known as carbonate dehydratase VB, is one of two isoforms of CA V. It localizes to the mitochondria and is involved in metabolic processes. CA VB is predominantly expressed in heart, pancreas, lung, placenta, kidney and skeletal muscle. It exhibits highest homology with family member CA VA (the second isoform of CA V); however, unlike CA VA, it is not expressed in the liver, suggesting that it plays a significantly different physiological role.
Specifications
Q9Y2D0 | |
Blocking Assay, Control | |
11238 | |
100 ÎĽL | |
7330410H16Rik; Ca5b; Car5b; Carbonate dehydratase VB; carbonic anhydrase 5 B; carbonic anhydrase 5 b, mitochondrial; Carbonic anhydrase VB; carbonic anhydrase VB, mitochondrial; carbonic dehydratase; CarVb; CAVB; CA-VB; D730005F19Rik | |
CA5B | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Carbonic Anhydrase VB (aa 176-279) Control Fragment | |
RUO | |
Carbonic Anhydrase VB | |
Unconjugated | |
Recombinant | |
GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.