missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Carbonic Anhydrase IX (aa 335-410) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP103210

Product Code. 30195334

  • 3150.00 NOK / 100µL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Description

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111410 (PA5-111410. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Carbonic anhydrase (CA) is an enzyme that assists rapid interconversion of carbon dioxide and water into carbonic acid, protons, and bicarbonate ions. It is abundant in all mammalian tissues. There are many genes that are inducible by hypoxia, via HIF-1 alpha. CA IX is one of the most inducible genes because of its stability and location within the membrane. Carbonic anhydrases have a widespread role in regulating pH in normal tissues, by regulating hydrogen ion (H+) flux. The pH is important in cell death under hypoxia, thus a blockade of CA IX results in increased cell death under hypoxia. Therefore, CA IX has become a reliable histochemical marker of hypoxia.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

Q16790
Blocking Assay, Control
768
100 ÎĽL
Ca9; CA-9; CAIX; CA-IX; Car9; Carbonate dehydratase IX; carbonic anhydrase 9; Carbonic anhydrase IX; carbonic dehydratase; G250; Membrane antigen MN; membrane antigen MN homolog; MN; MN/CA9; P54 / 58 N; P54/58 N; pMW1; RCC-associated antigen G250; RCC-associated protein G250; renal cell carcinoma-associated antigen G250
CA9
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human Carbonic Anhydrase IX (aa 335-410) Control Fragment
RUO
Carbonic Anhydrase IX
Unconjugated
Recombinant
PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates

Certificates

A lot number is required to show results for certificates. To find your lot number on previous orders use our order status area.

1 results found
Lot Number Certificate Type Date Catalog Number
Lot NumberAC4642349 Certificate TypeCertificate of Analysis Date03/03/2025 Catalog Number
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human Carbonic Anhydrase IX (aa 335-410) Control Fragment Recombinant Protein > 100 ÎĽL; Unlabeled

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.