Learn More
Invitrogen™ Human Carbonic Anhydrase III (aa 190-260) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP92483
Description
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82931 (PA5-82931. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10. 3 kb and contains seven exons and six introns.
Specifications
P07451 | |
Blocking Assay, Control | |
761 | |
100 ÎĽL | |
BB219044; CA III; Ca3; CAH3; CAIII; CA-III; CAIII (Muscle); Car3; Car-3; Carbonate dehydratase III; carbonic anhydrase 3; Carbonic anhydrase III; carbonic anhydrase III, muscle specific; carbonic anhydrase-like protein; EC 4.2.1.1; epididymis secretory sperm binding protein Li 167 mP; HEL-S-167 mP | |
Ca3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Carbonic Anhydrase III (aa 190-260) Control Fragment | |
RUO | |
Carbonic Anhydrase III | |
Unconjugated | |
Recombinant | |
YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.