Learn More
Invitrogen™ Human Carbonic Anhydrase I (aa 12-150) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP102412
Description
Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82254 (PA5-82254. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Variants of this gene have been described in some populations. Multiple alternatively spliced variants, encoding the same protein, have been identified. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature.
Specifications
P00915 | |
Blocking Assay, Control | |
759 | |
100 ÎĽL | |
AW555628; CA I; CA1; ca1 {ECO:0000250; CAB; CA-I; CA-I {ECO:0000250; Car1; Car-1; Carbonate dehydratase I; carbonate dehydratase I {ECO:0000250; carbonic anhydrase 1; carbonic anhydrase 1 {ECO:0000250; Carbonic anhydrase B; carbonic anhydrase I; carbonic anhydrase I {ECO:0000250; epididymis secretory protein Li 11; HEL-S-11; UniProtKB:P00915} | |
CA1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Carbonic Anhydrase I (aa 12-150) Control Fragment | |
RUO | |
Carbonic Anhydrase I | |
Unconjugated | |
Recombinant | |
NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.