missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GLTP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3505.00 NOK - 5500.00 NOK
Specifications
Antigen | GLTP |
---|---|
Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18339175
|
Bio-Techne
NBP3-17497-25UL |
25 μg |
3505.00 NOK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18329354
|
Bio-Techne
NBP3-17497-100UL |
100 μg |
5500.00 NOK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GLTP Polyclonal antibody specifically detects GLTP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
GLTP | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human | |
glycolipid transfer protein | |
This antibody was developed against Recombinant Protein corresponding to amino acids: RGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYA | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Purified | |
RUO | |
PBS, pH 7.2, 40% glycerol | |
51228 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
GLTP Rabbit anti-Human, Polyclonal, Novus Biologicals™