missing translation for 'onlineSavingsMsg'
Learn More

G3BP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

3545.00 NOK - 4760.00 NOK

Specifications

Antigen	G3BP1
Dilution	Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18439800 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-83404-25ul	25 μL	3545.00 NOK 25µL		Please sign in to purchase this item. Need a web account? Register with us today!

18791324 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-83404	0.1 mL	4760.00 NOK 0.10mL		Please sign in to purchase this item. Need a web account? Register with us today!

Description

G3BP1 Polyclonal specifically detects G3BP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen	G3BP1
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	ATP-dependent DNA helicase VIII, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, G3BP-1, G3BPRas-GTPase-activating protein SH3-domain-binding protein, GAP binding protein, GAP SH3 domain-binding protein 1, GTPase activating protein (SH3 domain) binding protein 1, hDH VIII, HDH-VIII, MGC111040, ras GTPase-activating protein-binding protein 1, RasGAP-associated endoribonuclease G3BP
Gene Symbols	G3BP1
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of human G3BP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Core ESC Like Genes, Stem Cell Markers
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	10146
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

G3BP1 Antibody, Novus Biologicals™

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

G3BP1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents