missing translation for 'onlineSavingsMsg'
Learn More

ETV6/Tel Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

3405.00 NOK - 4675.00 NOK

Specifications

Antigen	ETV6/Tel
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50, Immunofluorescence
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18427560 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-80695-25ul	25ul	3405.00 NOK 25µL		Please sign in to purchase this item. Need a web account? Register with us today!

18254407 View Documents missing translation for 'viewProductCertificates'	Bio-Techne NBP1-80695	0.1 mL	4675.00 NOK 0.10mL		Please sign in to purchase this item. Need a web account? Register with us today!

Description

ETV6/Tel Polyclonal specifically detects ETV6/Tel in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	ETV6/Tel
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	ETS translocation variant 6, ets variant 6, ets variant gene 6 (TEL oncogene), ETS-related protein Tel1, Tel, TEL/ABL, TEL1, TELTEL1 oncogene, transcription factor ETV6
Gene Symbols	ETV6
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50, Immunofluorescence
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	P41212
Gene ID (Entrez)	2120
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

ETV6/Tel Antibody, Novus Biologicals™

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

ETV6/Tel Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents