missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DYSFIP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3505.00 NOK - 5500.00 NOK
Specifications
Antigen | DYSFIP1 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18329436
|
Bio-Techne
NBP3-17243-25UL |
25 μg |
3505.00 NOK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18354904
|
Bio-Techne
NBP3-17243-100UL |
100 μg |
5500.00 NOK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DYSFIP1 Polyclonal antibody specifically detects DYSFIP1 in Human samples. It is validated for ImmunofluorescenceSpecifications
DYSFIP1 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Human | |
dysferlin interacting protein 1, dysferlin interacting protein 1 (toonin), dysferlin-interacting protein 1, dysferlin-interacting protein 1 (toonin), MGC138299, toonin | |
This antibody was developed against Recombinant Protein corresponding to amino acids: YLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
Polyclonal | |
Purified | |
RUO | |
PBS, pH 7.2, 40% glycerol | |
116729 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title