missing translation for 'onlineSavingsMsg'
Learn More
Learn More
-Immunohistochemistry-Paraffin-NBP3-15389-img0001.jpg-650.jpg)
-Western-Blot-NBP3-15389-img0002.jpg-650.jpg)
Chymase/CMA1/Mast Cell Chymase Rabbit anti-Human, Mouse, Rat, Clone: 2O4P8, Novus Biologicals™
Rabbit Monoclonal Antibody
1815.00 NOK - 4690.00 NOK
Specifications
| Antigen | Chymase/CMA1/Mast Cell Chymase |
|---|---|
| Clone | 2O4P8 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18329381
|
Bio-Techne
NBP3-15389-20UL |
20 μg |
1815.00 NOK
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18086144
|
Bio-Techne
NBP3-15389-100UL |
100 μg |
4690.00 NOK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Chymase/CMA1/Mast Cell Chymase Monoclonal antibody specifically detects Chymase/CMA1/Mast Cell Chymase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Chymase/CMA1/Mast Cell Chymase | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 | |
| A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 2O4P8 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 1215 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title