missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha-Galactosidase A/GLA Rabbit anti-Human, Mouse, Rat, Clone: 7G8T9, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Bio-Techne NBP3-16563-20UL
This item is not returnable.
View return policy
Description
alpha-Galactosidase A/GLA Monoclonal antibody specifically detects alpha-Galactosidase A/GLA in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
alpha-Galactosidase A/GLA | |
Monoclonal | |
Unconjugated | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Western Blot | |
7G8T9 | |
Western Blot 1:500 - 1:2000 | |
Agalsidase, agalsidase alfa, Alpha-D-galactosidase A, Alpha-D-galactoside galactohydrolase, alpha-D-galactoside galactohydrolase 1, alpha-gal A, alpha-galactosidase A, EC 3.2.1, EC 3.2.1.22, GALA, galactosidase, alpha, melibiase | |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human alpha-Galactosidase A/GLA (GLA) (P06280). FMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFG | |
20 μg | |
Cardiovascular Biology | |
2717 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction